DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAP and AT4G34660

DIOPT Version :9

Sequence 1:NP_001369075.1 Gene:CAP / 36084 FlyBaseID:FBgn0033504 Length:2568 Species:Drosophila melanogaster
Sequence 2:NP_567969.1 Gene:AT4G34660 / 829618 AraportID:AT4G34660 Length:368 Species:Arabidopsis thaliana


Alignment Length:398 Identity:91/398 - (22%)
Similarity:149/398 - (37%) Gaps:122/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  2038 RYRTQNPHRVQSV----------SSAVNVRNLNQD---EKLYGTMPNPIKSAQNSYKNQPGRIEN 2089
            |.|.|...:.|:|          |...:...|||.   ||||.:    .::|::..::....:|.
plant    10 RLREQVARQQQAVFKQFGGGGYGSGLADEAELNQHQKLEKLYIS----TRAAKHYQRDIVRGVEG 70

  Fly  2090 Y-TTGHSSV------SEKEKKEWWDEVMDIFNGN-LEQSKLSPLYTEGNLSRALA---KESGYTS 2143
            | .||...|      ||..:|  :.......||| |.::.|       |..||.|   ||.|   
plant    71 YIVTGSKQVEIGTKLSEDSRK--YGSENTCTNGNVLTRAAL-------NYGRARAQMEKERG--- 123

  Fly  2144 DSNLVFRKKEVPVSSPL------SPVE------------------------QKQAYKSLQAGGEP 2178
              |:: :.....|:.||      :|:|                        ::|| |:.::.|.|
plant   124 --NML-KALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQEAEAQATEVARRQA-KARESQGNP 184

  Fly  2179 PLLGFRKPAPEKPRDLDPNAPPIPPQPPVKGLSSYDFPYSTDTVDGSDVNIHFKTPIRHEQRQNL 2243
            .:|...:.|..|..||..|. .|..:.....|:|.:                       :|:|.|
plant   185 DILMKLESAEAKLHDLKSNM-TILGKEAASALASVE-----------------------DQQQKL 225

  Fly  2244 SEEELAIRQAEHMQKLYHEERRRKYLQELQ-DMNSRRH----------TDNFTP----SQKSPIA 2293
            :.|.| :...| .::.|| :|..:.|.:|: :|.|.|.          .|:..|    .:.:.:.
plant   226 TLERL-LSMVE-SERAYH-QRVLQILDQLEGEMVSERQRIEAPSTPSSADSMPPPPSYEEANGVF 287

  Fly  2294 LNRYDDFPTDVTLKSLVGPKTVARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIG 2358
            .::..|..|| ::...:|     ..||.:.|.|..|||...|:.:.:|:...:.|.|||.....|
plant   288 ASQMHDTSTD-SMGYFLG-----EVLFPYHGVTDVELSLSTGEYVVVRKVTGSGWAEGECKGKAG 346

  Fly  2359 LLPASYVE 2366
            ..|..|:|
plant   347 WFPYGYIE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNP_001369075.1 MDN1 <43..328 CDD:227596
Sorb 1959..2003 CDD:413404
SH3_Sorbs_1 2315..2367 CDD:212715 17/52 (33%)
SH3_Sorbs_2 2384..2436 CDD:212716
SH3_Sorbs_3 2514..2567 CDD:212714
AT4G34660NP_567969.1 BAR_SH3P_plant 45..254 CDD:153291 56/255 (22%)
SH3 303..354 CDD:418401 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.