DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAP and EndoA

DIOPT Version :9

Sequence 1:NP_001369075.1 Gene:CAP / 36084 FlyBaseID:FBgn0033504 Length:2568 Species:Drosophila melanogaster
Sequence 2:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster


Alignment Length:262 Identity:67/262 - (25%)
Similarity:113/262 - (43%) Gaps:66/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2214 DFPYSTDTVDGSDVNIHFKTPIRHEQRQNLSEEELAIRQAEHMQKL------YHEERRRKYLQEL 2272
            |..||.|    .::..:|..|:.|.|.::|.|      ...|.:||      :..:|||    :.
  Fly   127 DVKYSLD----DNIKQNFLEPLHHMQTKDLKE------VMHHRKKLQGRRLDFDCKRRR----QA 177

  Fly  2273 QDMNSRRHTDNFTPS-QKSPIALNRYDDFPTDVTLKSLVGPKTVARALFNFQGQTSKELSFRKG- 2335
            :|...|...|.|..| |.:.:.:....:..|: .:..||   |.|.||::|..|.:..|   :| 
  Fly   178 KDDEIRGAEDKFGESLQLAQVGMFNLLENDTE-HVSQLV---TFAEALYDFHSQCADVL---RGL 235

  Fly  2336 -DTIYIRRQIDANWYEGEHNAMIGLLPASYVEI--------VSRDGA---------------RTP 2376
             :|:..:|.      |.|.......:|.:.:::        ::.||.               |:|
  Fly   236 QETLQEKRS------EAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSP 294

  Fly  2377 SK-------RPSEGQARAKYNFQAQSGIELSLNKGELVTLTRRVDGNWFEGKIANRKGIFPCSYV 2434
            :|       |..:...:|.|:|:.::..||:..:.:::||..|||.|||||.:..|.|.||.|||
  Fly   295 AKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359

  Fly  2435 EV 2436
            :|
  Fly   360 QV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNP_001369075.1 MDN1 <43..328 CDD:227596
Sorb 1959..2003 CDD:413404
SH3_Sorbs_1 2315..2367 CDD:212715 12/53 (23%)
SH3_Sorbs_2 2384..2436 CDD:212716 22/51 (43%)
SH3_Sorbs_3 2514..2567 CDD:212714
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 35/145 (24%)
SH3_Endophilin_A 312..361 CDD:212737 22/48 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.