DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAP and POSH

DIOPT Version :9

Sequence 1:NP_001369075.1 Gene:CAP / 36084 FlyBaseID:FBgn0033504 Length:2568 Species:Drosophila melanogaster
Sequence 2:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster


Alignment Length:348 Identity:95/348 - (27%)
Similarity:134/348 - (38%) Gaps:110/348 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  2316 ARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYVEIVSRDGARTPSKRP 2380
            |.|||:|....:.:|.|:|||.|.|:.:||.||:.|:.|...|..|.:||::      ..|...|
  Fly   140 AYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKV------SVPLPMP 198

  Fly  2381 SEGQARAKYNFQAQSGIE---LSLNKGELVTLTRRVDGNWFEGKIANRKGIFPCSYVEV------ 2436
               |..|.|:|:.....|   |...|..::.:.||||.||.||:|....||||.::||:      
  Fly   199 ---QCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFVELNAAAKK 260

  Fly  2437 LTDIGAE-----------------DIAARTTTVIT------------------SQSTTNLRPNLD 2466
            |.|.|..                 .:.....||:|                  :.|:.|..||..
  Fly   261 LLDSGLHTHPFCHPPKQQGQRALPPVPVIDPTVVTESSSGSSNSTPGSSNSSSTSSSNNCSPNHQ 325

  Fly  2467 VLRTNI----------------------NNEFNTLTQNGAQPPNGILKETR-------TLHKTDA 2502
            :...|.                      .:..|.|...||  |..:|:..|       ..|:...
  Fly   326 ISLPNTPQHVVASGSASVRFRDKGAKEKRHSLNALLGGGA--PLSLLQTNRHSAEILSLPHELSR 388

  Fly  2503 LHVDTSSE-------------------------PLAYRALYKYRPQNSDELELLEGDVVHVLEKC 2542
            |.|.:|:.                         |..|.||:.|:|:.:|||||.:|.|..|.|:|
  Fly   389 LEVSSSTALKPTSAPQTSRVLKTTVQQQMQPNLPWGYLALFPYKPRQTDELELKKGCVYIVTERC 453

  Fly  2543 DDGWFVGTSQRTGCFGTFPGNYV 2565
            .||||.|.:. ....|.|||||:
  Fly   454 VDGWFKGKNW-LDITGVFPGNYL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNP_001369075.1 MDN1 <43..328 CDD:227596
Sorb 1959..2003 CDD:413404
SH3_Sorbs_1 2315..2367 CDD:212715 22/50 (44%)
SH3_Sorbs_2 2384..2436 CDD:212716 21/54 (39%)
SH3_Sorbs_3 2514..2567 CDD:212714 26/52 (50%)
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595 22/50 (44%)
SH3_SH3RF_2 199..251 CDD:212721 20/51 (39%)
SH3_SH3RF_3 424..477 CDD:212717 26/53 (49%)
SH3_SH3RF_C 782..836 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3230
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.