DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAP and Sh3rf3

DIOPT Version :9

Sequence 1:NP_001369075.1 Gene:CAP / 36084 FlyBaseID:FBgn0033504 Length:2568 Species:Drosophila melanogaster
Sequence 2:XP_017457292.1 Gene:Sh3rf3 / 294557 RGDID:1589772 Length:878 Species:Rattus norvegicus


Alignment Length:374 Identity:113/374 - (30%)
Similarity:156/374 - (41%) Gaps:119/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  2285 TPSQKSPIALNRYDDFPTDVTLKSLVGPKTVARALFNFQGQTSKELSFRKGDTIYIRRQIDANWY 2349
            |.|.....|.||  ..|....|..|    ..|:||::::|:...:|.|.|||.|.:||::|.|||
  Rat   168 TSSSLCDAATNR--SVPVAKNLSQL----PYAKALYSYEGKEPGDLKFNKGDIIILRRKVDENWY 226

  Fly  2350 EGEHNAMIGLLPASYVEIVSRDGARTPSKRPSEGQARAKYNFQAQSGIE----LSLNKGELVTLT 2410
            .||.....|.|||||::.:    ...|...|   |.:|.|:|:.:...:    |:..|.|::|:.
  Rat   227 HGELQGTHGFLPASYIQCM----RPLPQTLP---QGKALYDFEMKDRDQDKDCLTFTKDEVLTVI 284

  Fly  2411 RRVDGNWFEGKIANRKGIFPCSYVEVLTD-----IGAEDIAARTTT------VITSQSTT--NLR 2462
            ||||.||.||.:.::.||||..||| |.|     |..:.:....||      :::|..:|  |:.
  Rat   285 RRVDDNWAEGMLGDKIGIFPLLYVE-LNDSAKQLIEMDKLCPAATTAYNYDALLSSDPSTVANVA 348

  Fly  2463 PNLDVLRTNINNEFNTLTQNGA----QPPNGILKETRTLHKTDALHVD----------------- 2506
            |.            .||:.:||    |......|..:..|...||.|.                 
  Rat   349 PG------------PTLSSSGAVSAFQRRVDSKKNAKKRHSFTALSVTHKSSQASSHRHSMEISA 401

  Fly  2507 ----TSSEPLA---------------------------------------------------YRA 2516
                :||:|.|                                                   |.|
  Rat   402 PVLISSSDPRAAARIGELAHLSCAVPTQDSSSAGPVPTAIPRAAAVAGEQGMSPKVQLPLNMYLA 466

  Fly  2517 LYKYRPQNSDELELLEGDVVHVLEKCDDGWFVGTSQRTGCFGTFPGNYV 2565
            ||.|:||.:|||||.:|::..|||||.||||.|.|.:||..|.||||||
  Rat   467 LYAYKPQKNDELELRKGEMYRVLEKCQDGWFKGASLKTGISGVFPGNYV 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNP_001369075.1 MDN1 <43..328 CDD:227596
Sorb 1959..2003 CDD:413404
SH3_Sorbs_1 2315..2367 CDD:212715 24/51 (47%)
SH3_Sorbs_2 2384..2436 CDD:212716 22/55 (40%)
SH3_Sorbs_3 2514..2567 CDD:212714 33/52 (63%)
Sh3rf3XP_017457292.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.