DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAP and SPBC119.05c

DIOPT Version :9

Sequence 1:NP_001369075.1 Gene:CAP / 36084 FlyBaseID:FBgn0033504 Length:2568 Species:Drosophila melanogaster
Sequence 2:NP_595286.1 Gene:SPBC119.05c / 2539945 PomBaseID:SPBC119.05c Length:296 Species:Schizosaccharomyces pombe


Alignment Length:253 Identity:58/253 - (22%)
Similarity:83/253 - (32%) Gaps:90/253 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 EGEQSRESTP-VNANPTLASSQSSLLSAATPTP----TPTPTPADREQLAKDTNVSGGSTVSFGA 765
            ||...|.:.. |:||..|....:|.::|....|    .|.|.|..:..:.|    ..||..|..|
pombe    24 EGVVERSALDWVHANIHLQDGPASPVTAPAAQPVESSVPLPLPKRKSSVEK----RAGSVASAVA 84

  Fly   766 ASPLAATREEFVRNMDKVRELIEMTRREQEQGELPRSPSP-------------PPVPPPPASVPP 817
            |..|:....|              .|..:|..:||..|:|             ..:||||:...|
pombe    85 AMSLSQNSGE--------------KRTPEEPRKLPGVPAPQKQSEASSVNSSTEKLPPPPSYPGP 135

  Fly   818 YS----------------PESS--SFHLASLQLKRQESNDSH-------------------CSDS 845
            .:                |::.  .||...:.:..:..|:..                   ..||
pombe   136 NTAHKNVERVLAMYDFPGPDAGDLGFHAGEVIIVLEHVNNDWWRGELNGKEGIFPSNYVRLLEDS 200

  Fly   846 TTHSQCTAINLASPPPPPTAQ--PP-----TPPLR-QKPAPPPVPQPVSPPAPPTPQS 895
            ...:|        |||||..|  ||     .||:: |:.|.||...|. ||....||:
pombe   201 AVKAQ--------PPPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPY-PPVQAYPQA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNP_001369075.1 MDN1 <43..328 CDD:227596
Sorb 1959..2003 CDD:413404
SH3_Sorbs_1 2315..2367 CDD:212715
SH3_Sorbs_2 2384..2436 CDD:212716
SH3_Sorbs_3 2514..2567 CDD:212714
SPBC119.05cNP_595286.1 SH3 142..195 CDD:214620 4/52 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47417
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.