DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and AT5G48190

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_199630.1 Gene:AT5G48190 / 834872 AraportID:AT5G48190 Length:102 Species:Arabidopsis thaliana


Alignment Length:31 Identity:7/31 - (22%)
Similarity:15/31 - (48%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 FYYVEASEEVLRVLEHYQRIGLADVFEWNVQ 273
            |.:|...|.:..|:|     .|.:.|::.::
plant    13 FLHVPVKETISSVME-----SLEEYFQFTIE 38

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 7/31 (23%)
AT5G48190NP_199630.1 Glyco_tranf_GTA_type <2..>101 CDD:299700 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.