DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and GALS2

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_199280.1 Gene:GALS2 / 834496 AraportID:AT5G44670 Length:519 Species:Arabidopsis thaliana


Alignment Length:354 Identity:72/354 - (20%)
Similarity:121/354 - (34%) Gaps:104/354 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 VHNNTFAAWSIMCP--------LHASRRSPLRLPQAVALAYASNRLSHLSPTFIQISYPRNMTNM 201
            |.|.||.:.:::.|        |||:.....|        ..::.:..|:.|...:.:....:|:
plant   194 VVNCTFPSNTVINPKNTGGTLLLHATTGDTDR--------NITDSIPVLTETPNTVDFALYESNL 250

  Fly   202 FGRSRPTISVCVGPLHENYSNVLRLVEFVEMY-RLQG-ATHFYFYYVEA-SEEVLRVLEHYQRIG 263
            ..|.:.....|...|:.|.| ..|:.|::..: |..| .:||..:.... :|||..||:.:..:|
plant   251 RRREKYDYLYCGSSLYGNLS-PQRIREWIAYHVRFFGERSHFVLHDAGGITEEVFEVLKPWIELG 314

  Fly   264 LADVFEWNVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYAA----VVDLDE-VVMPLKHN---- 319
            ...|.:...|... |.:|.......|||::|      :|:.|    ..|:|| :.:|.|.:    
plant   315 RVTVHDIREQERF-DGYYHNQFMVVNDCLHR------YRFMAKWMFFFDVDEFIYVPAKSSISSV 372

  Fly   320 --TLADY----LRQ-------CDEGRTAGFVFRNVFFHRRDSNDTFNAPSHVLNRLLYTQSKVRR 371
              :|.:|    :.|       |.:|......:|...|.:....|....|              ||
plant   373 MVSLEEYSQFTIEQMPMSSQLCYDGDGPARTYRKWGFEKLAYRDVKKVP--------------RR 423

  Fly   372 TLEVLPAYIRSKVVVNARAIVEMGNH-------QVYRAAPGYADHVVHPTVGLLFHY-------R 422
            .         .|..|..|.:...|.|       :.|..|.|...:         |||       |
plant   424 D---------RKYAVQPRNVFATGVHMSQHLQGKTYHRAEGKIRY---------FHYHGSISQRR 470

  Fly   423 DKC---------INCKMVLIVDYTARRFG 442
            :.|         ::.....::|.|.|..|
plant   471 EPCRHLYNGTRIVHENNPYVLDTTMRDIG 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 53/252 (21%)
GALS2NP_199280.1 Glyco_transf_92 256..518 CDD:396317 59/284 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.