DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and GALS3

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_193750.1 Gene:GALS3 / 827763 AraportID:AT4G20170 Length:504 Species:Arabidopsis thaliana


Alignment Length:206 Identity:45/206 - (21%)
Similarity:88/206 - (42%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 VHNNTFAAWSIMCP--------LHASRRSP-LRLPQAVALAYASNRLSHLSPTFIQISYPRNMT- 199
            |.|.||::.|.:.|        |||:...| |.|..:::               :....|:::. 
plant   180 VVNCTFSSISAVNPQNSGGTLILHATTGDPTLNLTDSIS---------------VLTEPPKSVDF 229

  Fly   200 NMFGRSRPT----ISVCVGPLHENYSNVLRLVEFVEMY-RLQG-ATHFYFYYVEAS---EEVLRV 255
            :::..::.|    ...|...|:.|.| ..|:.|::..: |..| .:||..:  :|.   |||..|
plant   230 DLYNSTKKTKKYDYLYCGSSLYGNLS-PQRVREWIAYHVRFFGERSHFVLH--DAGGIHEEVFEV 291

  Fly   256 LEHYQRIGLADVFEWNVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDEVV-MPLKHN 319
            |:.:..:|...:.:...|... |.:|.......|||::|...:..:.:  ..|:||.: :|:| .
plant   292 LKPWIELGRVTLHDIRDQERF-DGYYHNQFMIVNDCLHRYRFMTKWMF--FFDVDEFLHVPVK-E 352

  Fly   320 TLADYLRQCDE 330
            |::..:...:|
plant   353 TISSVMESLEE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 31/128 (24%)
GALS3NP_193750.1 Glyco_transf_92 241..448 CDD:396317 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.