DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and AT3G27330

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_189369.1 Gene:AT3G27330 / 822354 AraportID:AT3G27330 Length:913 Species:Arabidopsis thaliana


Alignment Length:376 Identity:76/376 - (20%)
Similarity:140/376 - (37%) Gaps:102/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IVGNVRMDDEQMTIGSLRIFAILPERLRD-SSINCIVRFSDFSSQE--IKAEEAGAMHDVHNNTF 150
            :|.:..:|.:..|:..::...:.|.|:.| |...|:..: ||:...  |:::...|..::     
plant   169 LVYDAVIDYDNSTVVFVKGLNLRPGRVADVSRYECVYGW-DFAKHNRLIRSDVITAAQEI----- 227

  Fly   151 AAWSIMCPLHASRRSPLRL---PQAV-ALAYASNRLSHLSPTFIQISYPRNMTNMFGRSRPTISV 211
                :.|      |:||.:   |:|. .....|.|:...:.....|:.|..:.|. .|.:| ..:
plant   228 ----VRC------RTPLAVLDGPKAARGPVKVSVRIKGGTGMLPSIAQPVRIINP-PRKKP-FQM 280

  Fly   212 CVGPLHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHM 276
            ||..:..|.:.|||  |:|..:...|...::.|...:.::::..:|:.:|.|      :|:..|.
plant   281 CVCTMTRNAAAVLR--EWVMYHAGIGVQRWFIYDNNSDDDIIAEIENLERRG------YNISRHF 337

  Fly   277 ------QDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVMPLKHNTLADYLRQCDEGRTAG 335
                  |:       |.|::|..||.  .:..:.|.:|:||..          |:   ..|.|..
plant   338 WPWIKTQE-------AGFSNCAIRAK--SDCDWIAFIDVDEFF----------YI---PSGETLT 380

  Fly   336 FVFRNVFFHRRDSNDTFNAPSHVLNRLLYTQSKVRRTLEVLPAYIRSKVVVNARAIVEMGNHQVY 400
            .|.||  :...||......|.|...                |:.:||:    .|:.|        
plant   381 SVIRN--YTTTDSIGEIRTPCHSFG----------------PSGLRSR----PRSGV-------- 415

  Fly   401 RAAPGYADHVV----HPTVGLLFHYRDKCINCKMVLIVDYTARRFGSLLFD 447
              ..||...||    |.::     .|.:.:|..::.:|.:...|.|....|
plant   416 --TSGYTCRVVLPERHKSI-----IRPEAMNATLINVVHHFHLRDGFTFAD 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 45/223 (20%)
AT3G27330NP_189369.1 Glyco_transf_92 276..486 CDD:279961 52/252 (21%)
RING 724..766 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.