DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and GALS1

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_565768.1 Gene:GALS1 / 817922 AraportID:AT2G33570 Length:496 Species:Arabidopsis thaliana


Alignment Length:243 Identity:56/243 - (23%)
Similarity:88/243 - (36%) Gaps:85/243 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 CVGPLHENYSNVLRLVEFVEMYR--LQGATHFYFYYV-EASEEVLRVLEHYQRIGLADVFEWNVQ 273
            |...|:.|.| ..|:.|::..:.  ....:||.|:.. ..|.||.:|||.:.|.|...|  .|::
plant   236 CGSSLYGNVS-ASRMREWMAYHAWFFGDKSHFVFHDAGGVSPEVRKVLEPWIRAGRVTV--QNIR 297

  Fly   274 AHMQ-DVHYAGIVAQFNDCVYRANVVDNFRYAA----VVDLDEVVMPLKHNTL------------ 321
            ...| |.:|.......|||::|      :||||    ..|:||.:.....|||            
plant   298 DQSQYDGYYYNQFLIVNDCLHR------YRYAANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQ 356

  Fly   322 ------------------ADYLRQCDEGRTAGFVFRNVFFH------RRDSNDTFNAPS------ 356
                              .||.||        :.|..:.|.      |||......|.:      
plant   357 FTIEQNPMSSVLCINDSSQDYPRQ--------WGFEKLLFKDSRTKIRRDRKYAIQAKNAFATGV 413

  Fly   357 ----HVLNRLLY-TQSKVR-----RTL--------EVLPAYIRSKVVV 386
                :::.:.|: |::|:|     .|:        |:||...:.||.:
plant   414 HMSENIVGKTLHKTETKIRYYHYHNTITVHEELCREMLPNSAKKKVTL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 56/243 (23%)
GALS1NP_565768.1 Glyco_transf_92 231..439 CDD:396317 50/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.