DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and C35A5.10

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001023700.1 Gene:C35A5.10 / 3565313 WormBaseID:WBGene00044016 Length:286 Species:Caenorhabditis elegans


Alignment Length:241 Identity:45/241 - (18%)
Similarity:75/241 - (31%) Gaps:82/241 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VASAMLVLVYISMRSSLNERLREDLAKAQRQM---------IFERPNPHWDYSNSWRRIGNSTLR 75
            :|....:||.:.:.||...  .:||.:::|||         :.:.|      .||.....|:...
 Worm     1 MAKIFCMLVVLLVSSSFCS--AKDLKRSKRQMQVYYMCNGGVSQYP------CNSNNNCNNNNCN 57

  Fly    76 HEIYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAILPERLRDSSINCIVRFSDFSSQEIKAEEAG 140
            ...|           ||.               .|||....:.::||....::.:..:.......
 Worm    58 FNNY-----------GNQ---------------VILPSSFYNPNMNCNSNCNNLNCNQYSGSWLN 96

  Fly   141 AMHDVHN---NTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLSHLSPTFIQISYPRNMTNMF 202
            ..:..:|   |.::..:..|                    .||..::.:| :|..:|..|. |.:
 Worm    97 GQYVAYNMGSNAYSPCASSC--------------------CSNNNNNYNP-YINNNYNGNY-NPY 139

  Fly   203 GRSR------PTISVCVG-PLHENYSNVLRLVEFVEMYRLQGATHF 241
            |.|.      .||.|.|. |.....:|       |..|...||..|
 Worm   140 GTSNGGYNAYGTIPVNVNVPSSSTNTN-------VNQYLPYGAQQF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 10/34 (29%)
C35A5.10NP_001023700.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.