DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and CG11384

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster


Alignment Length:489 Identity:108/489 - (22%)
Similarity:174/489 - (35%) Gaps:141/489 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LNERLREDLAKAQRQMIFERPNP------HWD----------------------YSNSWRRIGNS 72
            |.|.::|:|.   ||:..|.|..      ||.                      ::..|:...|:
  Fly    62 LEEPIKEELV---RQLEQELPEVDYGFWYHWAKPMGYKINKTCAVYPDPLDLQLHNIYWQTFVNA 123

  Fly    73 TLRHEIYSAYFDARTDI-VGNVR-------MDDE------QMTIGSLR--IFAILPERLRDSSIN 121
            .:...:|:||.|.|..: :..||       :|:|      ||.....|  ||             
  Fly   124 NVTFRLYAAYLDKRKGLKLPTVRILATANQIDNEFPPTHCQMWFEGYRQPIF------------- 175

  Fly   122 CIVRFSDFSSQEIKAEEAGAMHDVHNNTFAAWS----------IMCPLHASRRSPL--RLPQAVA 174
              |..::|.|..::                ||.          :.||:.:....|.  ..|:.|:
  Fly   176 --VPVAEFLSVWVE----------------AWGNKPNLNYPHLLSCPVPSELPPPTVNSFPKTVS 222

  Fly   175 LA-----YASNRL------SHLSPTFIQISYPRNMTNMFGRSR----PTISVCVGPLHENYSNVL 224
            |.     .|.|.|      ....|..|..|......|...:|:    ....||:......|.::.
  Fly   223 LVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNFGVCLKGFDFPYVDLS 287

  Fly   225 -RLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHMQDV-HYAGIVAQ 287
             ||:|:.|:.|:.||:..|.|..:....|.|||::|||.|..::....:...|..: ||..::.|
  Fly   288 ERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQHMLLQ 352

  Fly   288 -------------FNDCVYRANVVDNFR--YAAVVDLDEVVMPLKHNTLADYLRQ---------- 327
                         :|||.||    :.:|  |...||:|||:|||..|.....|.|          
  Fly   353 HRKLEKRLNELIPYNDCFYR----NLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKG 413

  Fly   328 --CDEGRTAGFVFRNVFFHRRDSNDTFNAPSHVLNRLLYTQSKVRRTLEVLPAYIRSKVVVNARA 390
              | .||.....|.|.:|.:..:..:.:....:...|...|...|.....:|.. .:|...|||.
  Fly   414 GKC-AGRFPALCFINSYFTKVPTEFSNHEEQAIAGELYVLQHTQRIKNYSMPGR-ATKCFHNARL 476

  Fly   391 IVEMGNHQVYRAAPGYAD-HVVHPTVGLLFHYRD 423
            .:.:.||...:..||..: ..::.::..:.|||:
  Fly   477 SLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHYRE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 62/243 (26%)
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.