DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and ZK488.5

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_503257.1 Gene:ZK488.5 / 191330 WormBaseID:WBGene00022757 Length:521 Species:Caenorhabditis elegans


Alignment Length:376 Identity:83/376 - (22%)
Similarity:152/376 - (40%) Gaps:60/376 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PHWDYSNSWRRIGNST---LRHEIYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAILPERLRDSS 119
            |:.|....|.:...|.   |.|.:.|         |....:.::|:.:      .:..|...|..
 Worm   121 PNTDLHKQWSKKWKSNFKYLYHTLPS---------VAAAFLHEDQIVV------TLTAENQADEI 170

  Fly   120 INCIVRFSDFSSQEIKAEEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLSH 184
            :.|  |:.|...:||       |....:..|...::.|         .|.|.|..:.     :|.
 Worm   171 VYC--RYYDCRRREI-------MDHFESTIFPRGTVYC---------ARRPGAKFIT-----VSK 212

  Fly   185 LSPTFIQISYPRNMTNMFGRSRPTISVCVGPLHENYSNVLRLVEFVEMYRLQGATHFYFYYVEAS 249
            .....::.|.|  :.:..|:.:...:||:.||:.:....|::|:|:|.::|||||.|:.|....|
 Worm   213 TLKKILEYSVP--IVSRLGKPQHYFTVCMAPLYGDEPKFLQIVDFIEYHKLQGATFFHIYLRNVS 275

  Fly   250 EEVLRVLEHYQRIGLADVFEWNVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDE--V 312
            :....:|::|.:.|  |:....:|.|.....|.....|.|||.:|.....  ::.|::|:||  .
 Worm   276 DYDRVLLDNYAKTG--DIELITLQDHFWRADYMWHNGQINDCHHRNRYFS--KWTALIDIDERLE 336

  Fly   313 VMPLKHNTLADYLRQCDEGRTAGFVFRN--VFFHRRDSNDTFNAPSHVLNRLLYTQSKVRRTLEV 375
            :...|...:||||....:...|...||.  |..| .|:...:...:.:...:|:  .|.:...::
 Worm   337 MKSDKFKIVADYLDSIQDDSIANLHFRVKWVMKH-HDTPAKYENETQLKREMLF--HKYQNLSQL 398

  Fly   376 LPAYIRSKVVVNARAIVEM---GNHQVYRAAPGYADHVVHPTVGLLFHYRD 423
            ...:.:.|.::....:..|   |..::|:   |....||...||.:.|||:
 Worm   399 GAIWDQPKCIIRPENVAIMTIHGPREMYK---GEKMTVVPENVGFIRHYRN 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 56/220 (25%)
ZK488.5NP_503257.1 Glyco_transf_92 233..478 CDD:366762 57/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I4594
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I3596
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.