DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and Y116F11B.9

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001024218.1 Gene:Y116F11B.9 / 191021 WormBaseID:WBGene00013825 Length:514 Species:Caenorhabditis elegans


Alignment Length:306 Identity:55/306 - (17%)
Similarity:116/306 - (37%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LRDSSINCIVRFSDFSSQEIKAE-EAGAMHDVHNNTFAAW------SIMCPLHASRRSPLRLPQA 172
            |.|:::..::..:...:||...| |:|...|  :...:.|      ||:....:.|.:|....:.
 Worm    66 LGDNAVALVMSINLGRNQEEYLEIESGKSTD--SGEISIWAKNATTSILVNTPSIRVTPHNFCEM 128

  Fly   173 VALAYASNRLSHL---------SPTFIQISYPRNMTNMFGRSRPTISVCVGPLH--ENYSNVLRL 226
            |.:...:..|.::         ..|.|..|.|......|       .||:.||:  |.:.|.|. 
 Worm   129 VTIFATTQLLPNIQSILLVAEDGSTEIPFSIPSYKPRDF-------VVCLSPLYVFEQWQNFLL- 185

  Fly   227 VEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEW---NVQAHMQ-------DVHY 281
              .|.:|:..|. ..:.|.:.....:..:::.|:......:..|   |....|.       .|.:
 Worm   186 --SVHIYKKFGG-FLHLYLISVVSPLFSLMKQYESADYLKIQAWPRVNFPFIMPKYVDPFVGVEF 247

  Fly   282 AGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVMP-LKHNTLADYLRQCDEGRTAGFVFRNVFFHR 345
            ....|.:.||:.:..  ::.::...:|:|:|::| |....:.::.:.....:...:    :.:|:
 Worm   248 QNQAAAYTDCLLQYK--ESAQFITFLDIDDVIIPRLAPTYVEEFQKIIGSQKRISY----IIYHQ 306

  Fly   346 RDSNDTFNAPSHVLNRLLYTQSKVRRTLEVLPAYIRS--KVVVNAR 389
            :..|...:..|..     ::.||:.:.|:.......|  |:|.|.|
 Worm   307 KSYNLKVSKRSSE-----FSISKMLKNLKFRDGNFGSGQKIVANPR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 35/196 (18%)
Y116F11B.9NP_001024218.1 Glyco_transf_92 165..418 CDD:366762 36/205 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.