DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and Y105C5B.25

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_502914.1 Gene:Y105C5B.25 / 190901 WormBaseID:WBGene00013662 Length:462 Species:Caenorhabditis elegans


Alignment Length:323 Identity:67/323 - (20%)
Similarity:135/323 - (41%) Gaps:56/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 MHDVHNNT----FAAW------------------SIMCPLHASRRSPLRLPQAVALAYASNRLS- 183
            :.::||||    .||:                  .:.|..:..:|:.:|....:...:..:.:. 
 Worm    74 VENLHNNTEISILAAYVYPDHISITLITQHSIKKQLYCRYYDCKRNEIRGSAWLGTVFPESVIQC 138

  Fly   184 --HLSPTFIQIS---------YPRNMT-NMFGRSRPTISVCVGPLHENYSNVLRLVEFVEMYRLQ 236
              .:...|:.:|         .|..:| .:|......:||||.|::.|..:.|.:::|||..:|:
 Worm   139 PRRIGAEFVSVSENLEKESDITPVGLTFRVFEEPIHELSVCVAPMYGNEPSWLPIIDFVEHNKLE 203

  Fly   237 GATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHMQDVHYAGIVA----QFNDCVYRANV 297
            ||::||||..|..:...::|:.|.|.|..::.:      :||.::...:|    |..||..|:  
 Worm   204 GASYFYFYVGEIRDYDQKILDDYVRTGDIELVK------LQDKYHRVFIAWHLLQIQDCHLRS-- 260

  Fly   298 VDNFRYAAVVDLDEVVMPLKHNTLADYLRQCDEGRTAGFVFRNVFFHR-RDSNDTFNAPSHVLNR 361
            ..:.::.|.:||||.:......|:.|.||...:........::....: :|..|.:.....:...
 Worm   261 AYHSKWTAFIDLDERLSTNGPGTMIDVLRSIQDSSVGEVQLQSTTIVKDQDYPDKYENIEQLEQE 325

  Fly   362 LLYTQ--SKVRRTLEVLPAYIRSKVVVNARAIVEMGNHQVYRAAPGYADHVVHPTVGLLFHYR 422
            |::.:  ..|::|:.      .:|.::.:..|..|..||......|....:::.||..:.|.|
 Worm   326 LIFKKYNETVKKTMS------GTKPIIKSEKIGLMSIHQASAKYFGVKTLLLNITVASVRHLR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 53/221 (24%)
Y105C5B.25NP_502914.1 Glyco_transf_92 174..419 CDD:366762 53/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.