DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and Y97E10B.1

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_505043.2 Gene:Y97E10B.1 / 190816 WormBaseID:WBGene00022403 Length:514 Species:Caenorhabditis elegans


Alignment Length:198 Identity:41/198 - (20%)
Similarity:83/198 - (41%) Gaps:32/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ISVCVGPL--HENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWN 271
            :.||..||  .|.:.|.|..   ..:||..|| |...|.:.:......:::.|::.|...:..| 
 Worm   165 VVVCTSPLFVSEQWQNFLFA---AHIYRRFGA-HMNLYLISSVTSFYELMKEYEKEGYVTIQPW- 224

  Fly   272 VQAHM-----------QDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVMPLKHNTLADYL 325
            |:.|.           ..:.:....|...||:.:..  ::.|:...:|||:|::|....|.|:..
 Worm   225 VKVHFPGVPKEIADPYNQIEFRNQAASQTDCLLQFK--ESARFITFLDLDDVLIPRLAPTYAEEF 287

  Fly   326 RQCDEGRTAGFVFRNVFFHRRDSNDTFNAPSHVLNRL--LYTQSKVRRTLEVLPAYIRSKVVVNA 388
            ::..:|:..   ...:|:|:    :.::|   |..|.  .::..|:..:|.........|:||:.
 Worm   288 QKLMDGKKK---LAYIFYHK----ENYDA---VTTRFGSKFSLKKMFGSLACKHKRETGKIVVDP 342

  Fly   389 RAI 391
            |::
 Worm   343 RSL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 41/198 (21%)
Y97E10B.1NP_505043.2 Glyco_transf_92 163..419 CDD:366762 41/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.