DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and M02F4.2

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_508519.2 Gene:M02F4.2 / 187401 WormBaseID:WBGene00019736 Length:135 Species:Caenorhabditis elegans


Alignment Length:114 Identity:25/114 - (21%)
Similarity:42/114 - (36%) Gaps:27/114 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HW--DYSNSWR--RIGNSTLRHEIYSA-------------YFDARTDIVGNVRMDDEQMTI--GS 104
            ||  .:::|.:  :..:.||.|..:.|             ||...|. .....|....:||  ||
 Worm    20 HWVRSFTDSTKLTKDSDGTLLHHRFDAKWKRGEEVEKLFTYFPNNTS-AHVASMQKTAITIFNGS 83

  Fly   105 LRIFAILPERLRDSSINCIVRFSDFSSQEIKAEEAGAMHDVHNNTFAAW 153
            |.:|:.  :.::..: ||:   ....:|.|.....|...| |.:....|
 Worm    84 LPVFSF--DFIKGLN-NCV---RQMETQIICTSTGGMCRD-HMDKMTEW 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961
M02F4.2NP_508519.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.