DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and K08D9.2

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001343687.1 Gene:K08D9.2 / 187146 WormBaseID:WBGene00019524 Length:465 Species:Caenorhabditis elegans


Alignment Length:282 Identity:67/282 - (23%)
Similarity:122/282 - (43%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PHWDYSNSWRRIG----NSTLRHE--IYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAILPERLR 116
            ||......|..:|    .::||.|  :.||:            :..:|::|      .|..:.:.
 Worm    70 PHAANLQKWANLGPVESKNSLRGEARLISAF------------VYKDQISI------IITKQHIE 116

  Fly   117 DSSINCIVRFSDFSSQEIKAEEAGAMHDVHNNTF----AAWSIM-CPLHASRRSPLRLPQAVALA 176
            ...:.|:  :.|...:||.           |::|    |..|:: ||    ||..:   :.|:::
 Worm   117 KYDVTCL--YYDCKRREIA-----------NSSFPTQTAPMSVVTCP----RRVGV---EFVSVS 161

  Fly   177 YASNRLSHLSPTFIQISYPRNMTNMFGRSRP--TISVCVGPLHENYSNVLRLVEFVEMYRLQGAT 239
            :..|.:.|.....|..:|          :.|  .::||||||....|..|::.|.||.|||.||.
 Worm   162 FTDNHVPHEPIPLIYRAY----------NEPIYELAVCVGPLFGTESKWLQIAESVEHYRLLGAK 216

  Fly   240 HFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYA 304
            :|||.....:|...::|.:|.:.|.|:...:..| | :.:::.....|..:|.||:..  :.::.
 Worm   217 YFYFTLFNINEYDFKILSYYAKFGYAEYTHYITQ-H-KKLNWKAHSIQTQECHYRSRF--HSKWV 277

  Fly   305 AVVDLDEVVMPLKHNTLADYLR 326
            ..||:||.::....::|..:||
 Worm   278 INVDIDERLVWTHSDSLLHFLR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 37/118 (31%)
K08D9.2NP_001343687.1 Glyco_transf_92 184..427 CDD:366762 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.