DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and F36F12.3

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001300099.1 Gene:F36F12.3 / 185362 WormBaseID:WBGene00018094 Length:251 Species:Caenorhabditis elegans


Alignment Length:225 Identity:56/225 - (24%)
Similarity:88/225 - (39%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VCVGPLHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAH 275
            :||||.:......|:||||||..|:...:.|:|...:........|:.|:|.|:|:...  :|..
 Worm     1 MCVGPFYGADRKWLQLVEFVEHMRIFEVSMFFFTVFDMDAYSRLALDEYERQGIAETTV--IQTE 63

  Fly   276 MQDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDE-VVMPLKHNTLADYLRQCDEGRTAGFVFR 339
            .:.:.:...:.|.:||.:|:..:.  |:....|:|| .||.....||...||..|..      ..
 Worm    64 YEQLDWMFHLLQLHDCFHRSKYIS--RWVINADIDERFVMFQPETTLIQLLRSQDAN------VG 120

  Fly   340 NVFFHRRDSNDTFNAPSHVLNRLLYTQSKVRRTLEVLPA-----------YIRSKVVVNARAIVE 393
            .:.|..|....|.|:|....|        ::.|:|.|.|           :..||.:.....:..
 Worm   121 ELNFQARRIQKTENSPQKFTN--------LQDTIENLEALKFRNTTRTQIWESSKSIYRPEMVAV 177

  Fly   394 MGNHQVYRAAPG-YADHVVHPTVGLLFHYR 422
            ...|..:...|| ...:|...|.|.. |||
 Worm   178 QTYHHTHLQYPGVIVKNVPRETAGFR-HYR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 56/225 (25%)
F36F12.3NP_001300099.1 Glyco_transf_92 1..237 CDD:366762 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.