Sequence 1: | NP_001260858.1 | Gene: | CG12910 / 36082 | FlyBaseID: | FBgn0033502 | Length: | 466 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501294.1 | Gene: | C33H5.2 / 183184 | WormBaseID: | WBGene00016371 | Length: | 507 | Species: | Caenorhabditis elegans |
Alignment Length: | 362 | Identity: | 66/362 - (18%) |
---|---|---|---|
Similarity: | 120/362 - (33%) | Gaps: | 110/362 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 182 LSHLSPTFIQISYPRNMTNMFGRSRPTISVCVGPL--HENYSNVLRLVEFVEMYRLQGATHFYFY 244
Fly 245 YVEASEEVLRVLEHYQRIGLADVFEW------NVQAHMQDVH----YAGIVAQFNDCVYRANVVD 299
Fly 300 NFRYAAVVDLDEVVMPLKHNTLADYLRQCDEGRTAGFVFRNVFFHRRDSNDTFNAP--SHVLNRL 362
Fly 363 LYTQSKVRRTLEV------------------------LPAY-IRSKVVVNARAI------VEMGN 396
Fly 397 HQVYRAAPGYADH----VV-----------------HPTVGLLF-------HYRDKCINCKMVLI 433
Fly 434 VDYTARRFGSLLFDRV--------------DNTCLEV 456 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12910 | NP_001260858.1 | Glyco_transf_92 | 209..423 | CDD:279961 | 50/286 (17%) |
C33H5.2 | NP_501294.1 | Glyco_transf_92 | 155..412 | CDD:279961 | 46/268 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4735 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D561250at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |