DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and C33H5.2

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_501294.1 Gene:C33H5.2 / 183184 WormBaseID:WBGene00016371 Length:507 Species:Caenorhabditis elegans


Alignment Length:362 Identity:66/362 - (18%)
Similarity:120/362 - (33%) Gaps:110/362 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LSHLSPTFIQISYPRNMTNMFGRSRPTISVCVGPL--HENYSNVLRLVEFVEMYRLQGATHFYFY 244
            :||...|.|..|.|..:       :..:.:|:.||  .|.:.|.|..|...:.|    ......|
 Worm   137 VSHDGLTDIPFSPPSAI-------KRDVVMCIAPLFVSEQWQNFLFAVHIYKKY----GGFMNLY 190

  Fly   245 YVEASEEVLRVLEHYQRIGLADVFEW------NVQAHMQDVH----YAGIVAQFNDCVYRANVVD 299
            .:........|::.|::.|...|..|      .|...:.|.|    :....|...||:.:..  :
 Worm   191 LISTINTFFAVMKEYEKEGYMKVQPWPKVNFPGVPMDIADTHGQIEFRSQTAAQTDCLLQYK--E 253

  Fly   300 NFRYAAVVDLDEVVMPLKHNTLADYLRQCDEGRTAGFVFRNVFFHRRDSNDTFNAP--SHVLNRL 362
            :.:|.|.:|||:|::|....|..:..::..:|:..    ...|.:.:::.:.|..|  |....:.
 Worm   254 SAQYLAFLDLDDVLIPRIAPTYIEEFQRIIKGKKP----LAYFLYHKENYEAFVTPNSSQFSLKN 314

  Fly   363 LYTQSKVRRTLEV------------------------LPAY-IRSKVVVNARAI------VEMGN 396
            ::...|.|...|.                        |..| :...|:.:.:.|      |:.||
 Worm   315 MFGSLKCRNFRETGKSVIDPQNANYTWLHYPPVLVNGLEKYEVEENVITHLKTINWVEDEVKTGN 379

  Fly   397 HQVYRAAPGYADH----VV-----------------HPTVGLLF-------HYRDKCINCKMVLI 433
            ..:..  |.|.|:    ::                 .|.:..||       :|.|..:.|.....
 Worm   380 GTIIE--PMYYDNSSATIISSKDIKDIEDDLQRMRNKPEIKKLFAELPKIRYYSDLVLKCYNEKF 442

  Fly   434 VDYTARRFGSLLFDRV--------------DNTCLEV 456
            .||    |.|..::::              |.||:.|
 Worm   443 YDY----FYSGRYEKITCPGPQYCDFKQHPDITCMRV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 50/286 (17%)
C33H5.2NP_501294.1 Glyco_transf_92 155..412 CDD:279961 46/268 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.