DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and C13A2.6

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_504847.1 Gene:C13A2.6 / 182554 WormBaseID:WBGene00015723 Length:537 Species:Caenorhabditis elegans


Alignment Length:218 Identity:48/218 - (22%)
Similarity:81/218 - (37%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 ALAYASNRLSHLSPTFIQIS-----YPRNMTNMFGRSRPTISVCVGP--LHENYSNVLRLVEFVE 231
            |:...:|.:.:||...::||     .|..|.. :...:|.| ||:.|  :.|.:...|..|... 
 Worm   157 AVMARTNAVENLSKFEMEISGATVEIPFKMAR-YTAPKPVI-VCISPQFVAEQWQIFLMQVHVT- 218

  Fly   232 MYRLQGATHFYF-YYVEASEEVLR--------VLEHYQRIGLADV----------FEWNVQAHMQ 277
             ::..|..|.|. ..:|:..|::|        .|:::.|:..|:.          .||..||..|
 Worm   219 -HQFGGHLHIYLTSIIESFFELMREYEKRKYLTLDYWLRMKFAEAKTPFYEPNSNVEWRNQAGAQ 282

  Fly   278 DVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVMPLKHNTLADYLRQCDEGRTAGFVFR--- 339
                       .||:.:......|  .|..|:|:::.|....|   ||::          ||   
 Worm   283 -----------IDCLLQYKEAAEF--IAFFDMDDILFPKSFPT---YLQE----------FRAEW 321

  Fly   340 ------NVFFHRRDSNDTFNAPS 356
                  |..|:||..::...|.|
 Worm   322 QIDPNSNSIFYRRREHEFIKAKS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 39/178 (22%)
C13A2.6NP_504847.1 Glyco_transf_92 193..443 CDD:366762 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.