DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and C13A2.5

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_504849.2 Gene:C13A2.5 / 182553 WormBaseID:WBGene00015722 Length:536 Species:Caenorhabditis elegans


Alignment Length:405 Identity:75/405 - (18%)
Similarity:139/405 - (34%) Gaps:124/405 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYFALSALVASAMLVLVYISMRSSLNERLREDLAKAQRQMIFERPNPHWDYSNSWRRIGNSTLRH 76
            :||..      .::.|::|.:.|..|.|....|.|       :.|:.|   :.|.....|..:.|
 Worm    38 IYFLF------LLMTLLFILIISMWNTREINKLIK-------KLPDIH---NQSHALTENLAVSH 86

  Fly    77 -EIYSAYFD------ARTDIVGNVRMDDEQMTIGSLRIFAILPERLRDSSINCIVRFSDFSSQEI 134
             .|.|||:.      .|..|..|:.:|.                  ::|.:|....:...|    
 Worm    87 IFIVSAYYYPISKSLGRNAIAVNMVIDS------------------KNSHMNTTSHYFVGS---- 129

  Fly   135 KAEEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLSHL----SPTFIQISYP 195
                        ||::...|: ..|.:......|...|||:|...:.|:.|    ..|..:|.: 
 Worm   130 ------------NNSYTQKSV-AVLESETIEVCRYGSAVAMATMVDNLNRLEVESGGTRFEIPF- 180

  Fly   196 RNMTNMFGRSRPTISVCVGP--LHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEH 258
              ....:...:|.| .|:.|  :.|.:...:..|.....:   || |...|.....:....:::.
 Worm   181 --KIARYTAPKPVI-FCISPQFVAEQWEIFVFHVHVAHRF---GA-HMIIYLTSIVDSYFELMQE 238

  Fly   259 YQRIGLADVFEW-----------------NVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYAAV 306
            |:|||...:.:|                 |.:...|...:|..:.|:.:..         ::.:.
 Worm   239 YERIGYITIEKWLKMKFNNPETPFFEPNLNTELRNQAGAHADCLLQYKEAA---------QFISF 294

  Fly   307 VDLDEVVMPLKHNT-LADYLRQCDEGRTAGFVFRNVFFHRRDSNDT-------FN---------- 353
            .|:|::::||.:.| ..::..:.::...|    |::|:.||:...|       ||          
 Worm   295 FDMDDILVPLNYPTYFQEFTHEFNKNPGA----RSIFYGRREHRFTKGGSFSKFNFHEIVQSLES 355

  Fly   354 ----APSHVLNRLLY 364
                ||..|:...||
 Worm   356 SLTKAPKPVIKPELY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 36/197 (18%)
C13A2.5NP_504849.2 Glyco_transf_92 189..448 CDD:366762 37/200 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.