DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and C08B6.3

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_505599.2 Gene:C08B6.3 / 182389 WormBaseID:WBGene00007424 Length:439 Species:Caenorhabditis elegans


Alignment Length:367 Identity:73/367 - (19%)
Similarity:136/367 - (37%) Gaps:84/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PERLRDSSINCIVRFSDFS---SQEIKAEEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAV 173
            |:.|....|:.:.||..::   .:|||.::...:.:|  :...|:........|..:|.:....:
 Worm    49 PKELPTYKIDRMDRFEWYTRKWKEEIKKDQPPKIEEV--SMLRAYEFDVEYSISITTPGKYKAIL 111

  Fly   174 ALAYASNRLSHLSPTFIQISYPRNMTNMFGRS-----------------------------RPTI 209
            ...|.......|.|:|...::|..:.|...|.                             :..:
 Worm   112 YCRYFDESGVELLPSFQSYNFPEFVVNCQKRKGTKRVSVSTQATNNYTYPIELHDRTQREYKREL 176

  Fly   210 SVCVGPLHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQA 274
            |.|:.|::...:..|.|.|.:|.|:|||.||||||.....|....:|..|.|.|..:|.....:.
 Worm   177 SFCMSPIYGKEAKWLLLAEIIEHYKLQGMTHFYFYIFHIDEYSSAMLNDYVRTGEVEVTYLQERN 241

  Fly   275 HMQDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVMPLKH-NTLADYLRQCDEGRTAGFVF 338
            ..:.:|:.  :..|.||..|:..  ..:::...|:||.::..|: .|:.|||::.::.:.||..:
 Worm   242 DRELLHWQ--MVAFRDCTLRSRF--ESKWSLFSDIDERLLMTKYPGTILDYLKEVNDPKIAGVQY 302

  Fly   339 RNVFFHRRD----------------------SNDTFNAPSHVLNRLLYTQSKVRRTLEVLPAYIR 381
            |..:..:.:                      ::..|..|.|.:                      
 Worm   303 RQQWIMKTEFMPDKYEGDKQIDEWSPTLRWHNSSVFGPPGHTV---------------------- 345

  Fly   382 SKVVVNARAIVEMGNHQVYRAAPGYADHVVHPTVGLLFHYRD 423
             |.::....:..|..|:.....||:..|.:.|..|::.||||
 Worm   346 -KCIIMPEKVFAMWTHRPTMIFPGFYVHELTPEEGIIRHYRD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 52/236 (22%)
C08B6.3NP_505599.2 Glyco_transf_92 174..419 CDD:366762 54/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I4594
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I3596
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.