DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and C01G5.9

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_500991.2 Gene:C01G5.9 / 182076 WormBaseID:WBGene00015311 Length:426 Species:Caenorhabditis elegans


Alignment Length:380 Identity:95/380 - (25%)
Similarity:164/380 - (43%) Gaps:46/380 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IGNSTLRHEIYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAILPE-----------RLRDSSINC 122
            |||....|.  ..|||...:::..|.:::.:.|..    .|..|:           .:..|:.:.
 Worm    25 IGNFLSAHG--EDYFDEEYEVLKPVNLENLEPTTK----LAQKPKPQFEGVISKSVLIGYSNADK 83

  Fly   123 IVRFSDFSSQEIKAEEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVA----LAYASNRLS 183
            :..||.|:..:      |....:.:..:....:.|.|....|..: ..:|||    |....:..|
 Worm    84 LTIFSSFTGDD------GTTVILSSYGYLNRRVYCRLFDENRQEI-YQKAVAVFPELTIKCSESS 141

  Fly   184 HLSPTFIQIS-----YPRNMTNMF----GRSRPTISVCVGPLHENYSNVLRLVEFVEMYRLQGAT 239
            .:...|:.::     .|.||..::    .:::...:||:.||:.....||.|:||:|.|:||||.
 Worm   142 SVKAEFVAVTINKKDVPGNMKQIYKEKETKNKSEFTVCLAPLYGESPKVLMLMEFIEYYKLQGAD 206

  Fly   240 HFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYA 304
            ||..|....|:|...||:.|:.....:|.:...:....:.|......|..|||:|.....:  :.
 Worm   207 HFLIYSFNISKETENVLDFYRNSSNLEVIQMGNETKCLNRHRCRHEMQLQDCVFRTQKYSS--WV 269

  Fly   305 AVVDLDEVVMPL-KHNTLADYLRQCDEGRTAGFVFRNVFFHRRDSNDTFNAPSHVLNRLLYTQSK 368
            |.|||||.:|.: :.:||.||:|.|::.:.:...|| ..:..|.|..:..|| .:.|..:.|.  
 Worm   270 ATVDLDERIMMIDEKSTLLDYIRNCNDHKISELRFR-CQWTLRYSEISSGAP-QIENLPMITW-- 330

  Fly   369 VRRTLEVLPAYIRSKVVVNARAIVEMGNHQVYR-AAPGYADHVVHPTVGLLFHYR 422
             ..|..|.|....:|.::.:|.:..||.|.|.: ..|.|...:|.|.:.::.|||
 Worm   331 -HNTSHVAPQNHTTKSIIRSRNVDSMGVHGVQKFRNPIYGVRLVEPEIAVVRHYR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 67/216 (31%)
C01G5.9NP_500991.2 Glyco_transf_92 175..415 CDD:366762 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I4594
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I3596
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16972
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.