DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and F55C10.4

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_505887.1 Gene:F55C10.4 / 179573 WormBaseID:WBGene00010108 Length:517 Species:Caenorhabditis elegans


Alignment Length:431 Identity:78/431 - (18%)
Similarity:138/431 - (32%) Gaps:139/431 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IYSAYFDARTDIVGN------VRMDDEQMTIGSLRIFAILPERLRDSSINCIVRFSDFSSQEIKA 136
            |:|||:..::..:|.      ..|:...|.            ::.|..||.|             
 Worm    53 IHSAYYYPKSKSLGENAVVLVTTMNKRTMW------------KILDYKINMI------------- 92

  Fly   137 EEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLSHLSP-------TFIQISY 194
               |.....|:.|.|:      |....|...|....:.:| .:|.:.::..       ..::|.|
 Worm    93 ---GTNQSTHHTTRAS------LSTEHRIIERCDYMLIIA-QTNSIDNMDKLEIEAEGVLVEIPY 147

  Fly   195 PRNMTNMFGRSRPTISVCVGP--LHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLE 257
            .:   .::...:|.| .||.|  ..|.:...|..:...:.|   || |...|.|...|....::.
 Worm   148 KK---PIYIAPKPVI-FCVSPQFAAEQWQTFLVQLHVSKRY---GA-HLQLYIVSMVESYFNLIS 204

  Fly   258 HYQRIGLADVFEW-----------------NVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYAA 305
            .|:::||..:..|                 ||:...|    ||   ...||:.:..  ::..:..
 Worm   205 EYEKMGLVSIEPWLTIKFSSTDGPYLEPNRNVELRNQ----AG---AHTDCLLKYK--ESASFIG 260

  Fly   306 VVDLDEVVMPLKHNTLADYLRQCDEGRTAGFVFRNVFFHRRDSNDTFNAPSHVLNRLLYTQSKVR 370
            .:|:|::::|   |....|..:               |.|..:...|.:..| .::..|...||.
 Worm   261 SLDMDDILIP---NNANSYYEE---------------FEREYAGSQFISALH-YDKYDYKTIKVS 306

  Fly   371 RTLEVLPAYIRSKVVVNARAIVEMGNHQVY--------------RAA---PGYADHVVHPTVGLL 418
            .    |.:...|.:|.||..:......:.:              |||   |.|.|....|.:..|
 Worm   307 E----LRSQSLSAIVKNAERLSTKDTGKSFVRPERFNSTWSHWSRAAQKKPIYLDGYEKPILREL 367

  Fly   419 --------FHYRDKCINCKMVLIVDYTARRFGSLLFDRVDN 451
                    ||       .|.:.:.::.....|.:..:..||
 Worm   368 KTISNNGMFH-------LKNMYLTEFNDLGIGQIPLNPTDN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 51/257 (20%)
F55C10.4NP_505887.1 Glyco_transf_92 156..422 CDD:279961 56/290 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.