DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and K08D9.6

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_503885.2 Gene:K08D9.6 / 178760 WormBaseID:WBGene00019527 Length:530 Species:Caenorhabditis elegans


Alignment Length:296 Identity:64/296 - (21%)
Similarity:116/296 - (39%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SINCIVRFSDFSSQEIKAEEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLS 183
            ::|.:|...:|....:....|.| ::.|.....|.|.:..:.:.|.:        .:...:..:.
 Worm   104 ALNMVVDSKNFQMDGVVFSVAAA-NETHRQFLRAESQVEGVPSCRYT--------TVMAKTTTID 159

  Fly   184 HLSPTFIQIS-----YPRNMTNMFGRSRPTISVCVGP--LHENYSNVLRLVEFVEMYRLQGATHF 241
            :||...::||     .|..|.. :...:|.| :|:.|  :.|.:...:..|...  :|..|..|.
 Worm   160 NLSKFEMEISGNTVEIPFKMAR-YTAPKPVI-ICISPQFVAEQWQIFMMQVHVA--HRFGGHLHI 220

  Fly   242 YF-YYVEASEEVLR--------VLEHYQRIGLADV----FEWNVQAHMQDVHYAGIVAQFNDCVY 293
            |. ..||:...::|        .|:.:.|:...|.    ||.|  .|::..:.||  ||. ||:.
 Worm   221 YLTSIVESFFNLMREYEKRKYLTLDFWLRMKFTDTKTPFFEPN--RHVEWRNQAG--AQI-DCLL 280

  Fly   294 RANVVDNFRYAAVVDLDEVVMPLKHNT-LADYLRQCDEGRTAGFVFRNVFFHRRD-------SND 350
            :......|  .|..|:|:::.|..:.| |.::..:.:...|:    .::|:.||:       |..
 Worm   281 QYKEAAEF--IAFFDMDDILFPKTYPTYLQEFRAEWEVDPTS----NSIFYGRREHEFVKAKSFK 339

  Fly   351 TFNAPSHVLNRLLYTQSKVRRTLEVLPAYIRSKVVV 386
            |||.            .::..|||......|.||||
 Worm   340 TFNF------------KEIVSTLESSDTVKRGKVVV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 48/201 (24%)
K08D9.6NP_503885.2 Glyco_transf_92 186..435 CDD:366762 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.