DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and T15D6.12

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_493143.1 Gene:T15D6.12 / 173110 WormBaseID:WBGene00011786 Length:459 Species:Caenorhabditis elegans


Alignment Length:246 Identity:57/246 - (23%)
Similarity:97/246 - (39%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ISVCVGPLHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQ 273
            :::|:.|:: .||....:|.::|.:|..||:.|..||..|:::..:|||:|:.:|:.::..|   
 Worm   161 LTLCLQPVY-YYSQWQNIVLYIEAWRAHGASRFIVYYHSATKDTWKVLEYYRDMGIIEIRPW--- 221

  Fly   274 AHMQDVHYAGIVAQ-------FNDCVYRANVVDNFRY---------------AAVVDLDEVVMPL 316
                 .::..:..|       .:|.||      .|.|               .:|.|.|||::| 
 Worm   222 -----PNFGSLPPQIEKKYPKIDDSVY------GFSYFLALNLCILDIKTTIGSVADFDEVMVP- 274

  Fly   317 KHN-TLADYLRQCDEGRTAG-FVFRNVFFHRRDS--NDTFNAPSHVLNRLLYTQSKVRRTLEVLP 377
             || |:.:|..:...|...| .:|:|.:.....|  ::.|...|.                   |
 Worm   275 -HNGTMLEYASKEMTGTNVGALLFKNSYVSLEPSIYDNEFTGVSK-------------------P 319

  Fly   378 AYI----RSKVVVNARAIVEMGNHQVYRAAPGYADHVVHPTV--GLLFHYR 422
            .::    ..|.|.||..|.....|.|    ..:.|...|..|  |.|.|:|
 Worm   320 VFLDGTAAPKYVFNATVIDIAQTHWV----RSFTDSTKHTKVSDGTLLHHR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 57/246 (23%)
T15D6.12NP_493143.1 Glyco_transf_92 159..395 CDD:366762 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.