DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and F13G3.3

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_492062.1 Gene:F13G3.3 / 172475 WormBaseID:WBGene00008763 Length:501 Species:Caenorhabditis elegans


Alignment Length:361 Identity:78/361 - (21%)
Similarity:139/361 - (38%) Gaps:86/361 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIGNSTLRHE-----------IYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAILPERLRDSSIN 121
            ||.:..|.:|           ||||::..::..:|     |..|.|.....|.:| |::::..  
 Worm    31 RIDSPDLENEEVFHSAPYDIFIYSAFYYNKSKSLG-----DSSMVILMTADFEVL-EKVKNLE-- 87

  Fly   122 CIVRFSDFSSQEIKAE-EAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLSHL 185
             ::..:|.|.....|| |...:||.     ..|..|.   |:.:..|. |..:.::...|   |.
 Worm    88 -LLGINDTSRAMTSAELERVTIHDA-----CKWIAMT---ATAKIVLN-PSLLLVSLGGN---HA 139

  Fly   186 SPTFIQISYPRNMTNMFGRSRPTISVCVGPLH--ENYSNVLRLVEFVEMYRLQGATHFYFYYVEA 248
            ...|..:|         ...:|.: :|:.||.  ||:.|   |:..:.:|::.|| |.:.|....
 Worm   140 PIPFEVVS---------SEPKPVV-MCISPLFAAENWHN---LLVSLHVYKIFGA-HMHLYIRSI 190

  Fly   249 SEEVLRVLEHYQRIGLADVFEWN----VQAHMQD------VHYAGIVAQFNDCVYRANVVDNFRY 303
            ...:|.:|..|::.|.|.:..||    :....||      |.:....|...||:.|..  ::..:
 Worm   191 VSPMLEILRVYEQEGYATLKPWNRINLLNRDEQDFNPNLNVEFRSQAAAQTDCLLRYK--ESSEF 253

  Fly   304 AAVVDLDEVVMP--------------LKHNTLADYLRQCDEGRTAGFVFRNVFF----------- 343
            .|.||||::::|              .:|.|:|.:....:..|...:...|||.           
 Worm   254 VAFVDLDDLIIPRVADNYASEFRYLASEHPTVAYFTYSKENTRIKAYKRANVFSIEHVLRNIKHE 318

  Fly   344 HRRDSNDTFNAPSHVLNRLLYTQSKVRRTLEVLPAY 379
            .:.::......||.:.|..::...|..:.|.|.|.:
 Worm   319 QQTETGKMIAIPSKINNTWIHWPQKNLKKLAVKPEF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 46/208 (22%)
F13G3.3NP_492062.1 Glyco_transf_92 151..407 CDD:279961 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.