DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and LOC105945137

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_004917590.2 Gene:LOC105945137 / 105945137 -ID:- Length:432 Species:Xenopus tropicalis


Alignment Length:304 Identity:75/304 - (24%)
Similarity:135/304 - (44%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SPTFIQISY----PRNMTNMF-------GRSRPTISVCVGPLHENYSNVLRLVEFVEMYRLQGAT 239
            :||.:.:.:    |.:....|       ||.....:||...:..||:|||:.::.:|||::.||.
 Frog   133 TPTHVSVHWSPYEPHDSLTTFKILNRNPGRPTANFTVCFSAMFGNYNNVLQFIQTIEMYKILGAQ 197

  Fly   240 HFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHMQ------------DVHYAGIVAQFNDCV 292
            :...|....|.::.:||::|...|..:|..|::|.:::            ::.|.|.::..|||:
 Frog   198 NVMVYLNNCSRKMEKVLQYYTEEGTVEVIPWHIQRYLKVSDNWQYPNDGTEIGYYGQISALNDCI 262

  Fly   293 YRANVVDNFRYAAVVDLDEVVMPLKHNTLADYLR--QCDEGRTAGFVFRN-VFFHRRDSNDTFNA 354
            || |:..: ::..:.|.||:::|.||.|....:.  |....:...|.|.| :|.....||..|..
 Frog   263 YR-NMYSS-KFVVLNDQDEIILPFKHRTWDTMMESLQRKNPKVGIFQFENHIFPQTVVSNGNFTN 325

  Fly   355 PSH-----VLNRLLYTQSKVRRTLEVLPAYIRSKVVVNARAIVEMGNHQVYRAAPGYADHVVHPT 414
            .|.     ..|.|.|    :.|..:.|..|...|::::.||:::...|...:.   |...:..|.
 Frog   326 TSSWNRVPGSNLLQY----IHREPDRLSYYNARKMILDPRAVIQTSVHSTLKQ---YKRSMYVPL 383

  Fly   415 -VGLLFHYRDKCIN--CKMVLIVDYTARRFGSLLFDRVDNTCLE 455
             ..|::|.||...:  .:..||.|.|..|:...|...|:...|:
 Frog   384 HTALVYHCRDPLQHNLPRASLIKDRTIWRYNVSLIRNVNQALLK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 59/234 (25%)
LOC105945137XP_004917590.2 Glyco_transf_92 166..420 CDD:396317 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7544
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 1 1.000 - - FOG0003939
OrthoInspector 1 1.000 - - mtm9504
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.