DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and LOC100495391

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_002942012.2 Gene:LOC100495391 / 100495391 -ID:- Length:430 Species:Xenopus tropicalis


Alignment Length:459 Identity:114/459 - (24%)
Similarity:196/459 - (42%) Gaps:110/459 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NPH-WDYSNSWRRIGNS---------TLRHEIYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAIL 111
            ||: |  .|.|..:|.|         .|..:..:...|.||.|:... :|:.:..|  :||..|:
 Frog    24 NPYRW--QNLWHLVGTSMDPLPTCRGQLAEDTITPLKDHRTFIIAPY-VDNRERNI--IRILGIV 83

  Fly   112 PERLRDSSINCIVRFSDFSSQEIKAEEAGAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALA 176
            ...:::  :.|....:..:..:.|||     .|:|.:.|.             .|..|...:...
 Frog    84 HTEVKE--LYCYFCCAKATVLQHKAE-----IDIHVDRFG-------------FPYGLADIICAE 128

  Fly   177 YASNRLSHL----SPT--FIQIS-YP-RNMTNMFGRSRPTISVCVGPLHENYSNVLRLVEFVEMY 233
            ....|::|:    |||  |..:: :| ||...  |......:||:..:..||||||:.::.:|||
 Frog   129 PPDCRVAHVALDGSPTADFASLTVFPIRNREP--GVPTANFTVCISAMFGNYSNVLQFIQTIEMY 191

  Fly   234 RLQGATHFYFYYVEASEEVLRVLEHYQRIGLADVFEWNVQAHMQ------------DVHYAGIVA 286
            ::.||.....|....|.::..||::|...|..:|..|::|.:::            ::.|.|.::
 Frog   192 KILGAQKVTVYLNNCSRQMEEVLQYYTEEGTVEVIPWHIQRYLKVSHNWQYPDDGTEIGYYGQIS 256

  Fly   287 QFNDCVYRANVVDNFRYAAVVDLDEVVMPLKH---NTLADYLRQCDEGRTAG-FVFRNVFFHR-- 345
            ..|||:|| |:..: ::..:.|.||:::|.||   :|:.:.|::  |....| |:|.|..|..  
 Frog   257 ALNDCLYR-NMYSS-KFVVLNDQDEIILPFKHRTWDTMMESLQR--ENPNVGIFLFENHLFPHAA 317

  Fly   346 -RDSN--DT--------FNAPSHVL---NRLLYTQSKVRRTLEVLPAYIRS-KVVVNARAIVEMG 395
             .|.|  ||        ||...|.|   ||               |.:..| |::::.||:::..
 Frog   318 LTDGNFPDTSRWNGIPGFNLLRHTLREPNR---------------PDHFNSRKMIMDPRAVIQTS 367

  Fly   396 NHQVYRAAPGYADHV-VHPTVGLLFHYRD---KCINCKMVLIVDYTARRFGSLLFDRVDNTCLEV 456
            .|.|.:.   |.|.: |.....:::|.||   :.:| :..||.|....||...|...|::     
 Frog   368 VHSVLKQ---YKDSMFVSLESAMVYHCRDSQQEHLN-RSSLIEDTNIWRFNETLIRNVND----- 423

  Fly   457 FLNR 460
            .|||
 Frog   424 MLNR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 65/247 (26%)
LOC100495391XP_002942012.2 Glyco_transf_92 166..420 CDD:396317 74/276 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.