DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12910 and si:ch73-211l2.1

DIOPT Version :9

Sequence 1:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_002663252.1 Gene:si:ch73-211l2.1 / 100334791 ZFINID:ZDB-GENE-081105-10 Length:436 Species:Danio rerio


Alignment Length:420 Identity:96/420 - (22%)
Similarity:163/420 - (38%) Gaps:96/420 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HEIYSAYFDARTDIVGNVRMDDEQMTIGSLRIFAILPERLRDSSINCIVRFSDFSSQEIKAEEAG 140
            |.:.||:.|.|.|              |::|:.:|: :|.....:.|:     :.:.|...|...
Zfish    59 HFMVSAFIDHRLD--------------GAIRVISII-KRNNLQPLYCV-----YCTPEHVCETVE 103

  Fly   141 AMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALAYASNRLSHLSPT----FIQISYPRNMTNM 201
            ....:|.:.|.     .|.|.|.    .:.:...:..||:.|....||    .::|.|.....|:
Zfish   104 TEVQIHADHFG-----FPFHVSD----VICKGKNMQSASHVLITTHPTKNSYNLKIDYLLIKNNV 159

  Fly   202 F-GRSRPTISVCVGPLHENYSNVLRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIGLA 265
            . ...:...:||:..|..:|:|:|:..:.:|||:|.|..|...|...:..::.::|:||:..||.
Zfish   160 VTDNFKYNFTVCISNLFGSYNNILQFAQTMEMYKLLGIQHVVIYKTSSGPDLKKLLKHYESEGLL 224

  Fly   266 DVFE------------WNVQAHMQDVHYAGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVMPLKH 318
            ::..            ||.|.|..|:||.|.:...|:|:||.  :...||..:.|:||::||.|:
Zfish   225 EIVSWPIDKFLNASSGWNFQEHKGDLHYYGQLVTLNECIYRH--MYQSRYVLLNDIDEIIMPYKY 287

  Fly   319 N---TLADYLRQCDEGRTAGFVFRNVFFHRRDSNDT-------------FNAPSHVLNRLLYTQS 367
            :   :|.:.|:..|..:.. |:..|..|.:....|:             .|...|:.        
Zfish   288 SNLQSLMEDLQSADPSKGV-FIIENHVFPKTQFEDSGKFKRKEWKNIAGINIMEHIY-------- 343

  Fly   368 KVRRTLEVLPAYIRSKVVVNARAIVEMGNH-------QVYRAAPGYADHVVH---PTVGLLFHYR 422
               |..|....|..:|::||.|.:.:...|       :.|. .|.....:||   |..|.|    
Zfish   344 ---REPERKNVYNPAKMIVNPRKVEQTSVHSSLMIFGESYH-VPFNVCRIVHVREPLQGSL---- 400

  Fly   423 DKCINCKMVLIVDYTARRFGSLLFDRVDNT 452
                 .|..|.:|.....|...|...||.|
Zfish   401 -----TKEELFIDKRVWDFEKDLIPNVDRT 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 62/251 (25%)
si:ch73-211l2.1XP_002663252.1 Glyco_transf_92 166..419 CDD:279961 66/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.