DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and VAMP3

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_016858330.1 Gene:VAMP3 / 9341 HGNCID:12644 Length:122 Species:Homo sapiens


Alignment Length:91 Identity:56/91 - (61%)
Similarity:69/91 - (75%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWAN 108
            :.::|||||.:|||||.||||||:||||||||||||.:|||.|:.||||||..|.|||||.||.|
Human    11 SNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN 75

  Fly   109 MKMMIILGVIAVVLLIIVLVSVWPSS 134
            .||..| |:..:|:.||:::...|.|
Human    76 CKMWAI-GITVLVIFIIIIIGELPFS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 54/85 (64%)
VAMP3XP_016858330.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146528
Domainoid 1 1.000 125 1.000 Domainoid score I5484
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.