DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and SNC2

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_014972.3 Gene:SNC2 / 854505 SGDID:S000005854 Length:115 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:34/114 - (29%)
Similarity:67/114 - (58%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PILPP-PPNANDNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGE 81
            |.:|| ..|:..|.|            :|.|....:.::|:.|||||.|:.||.||.::|:.:.:
Yeast     9 PYVPPEESNSGANPN------------SQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIED 61

  Fly    82 RADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSV 130
            :||.|...|..|::.|.:::::.||.::||.:.|.::.::||::::|.:
Yeast    62 KADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 28/85 (33%)
SNC2NP_014972.3 SNC1 <1..96 CDD:227472 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I2186
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm9203
orthoMCL 1 0.900 - - OOG6_105078
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.