DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and VAMP721

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_171967.1 Gene:VAMP721 / 839419 AraportID:AT1G04750 Length:219 Species:Arabidopsis thaliana


Alignment Length:118 Identity:38/118 - (32%)
Similarity:63/118 - (53%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ANDNYNQFG-----------DH--QIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLS 77
            ||....:||           ||  :|       .||.:.:|:|.||.|:|..|:||||:|.:|:.
plant   103 ANSLNKEFGSKLKEHMQYCMDHPDEI-------SKLAKVKAQVSEVKGVMMENIEKVLDRGEKIE 160

  Fly    78 ELGERADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSV 130
            .|.::.:.|...|..|.....:::||.|..|||:.:|:..|.:.|::|:::||
plant   161 LLVDKTENLRSQAQDFRTTGTQMRRKMWLQNMKIKLIVLAIIIALILIIVLSV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 29/85 (34%)
VAMP721NP_171967.1 Longin 7..121 CDD:341428 4/17 (24%)
Synaptobrevin 127..>195 CDD:395764 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.