DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and Vamp8

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_038964377.1 Gene:Vamp8 / 83730 RGDID:620421 Length:116 Species:Rattus norvegicus


Alignment Length:89 Identity:29/89 - (32%)
Similarity:57/89 - (64%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQ 104
            :.:|...:::..|::|:.|..||..|||::|.|.:.|..|..:.:.||..:..|:..:.|:.||.
  Rat    20 SGSAGNDRVRNLQSEVEGVKNIMTQNVERILARGENLDHLRNKTEDLEATSEHFKTTSQKVARKF 84

  Fly   105 WWANMKMMIILGVIAVVLLIIVLV 128
            ||.|:||::|:.||.:::||::::
  Rat    85 WWKNVKMIVIICVIVLIILILIIL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 28/85 (33%)
Vamp8XP_038964377.1 R-SNARE_VAMP8 25..91 CDD:277221 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.