DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and VAMP713

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001331552.1 Gene:VAMP713 / 830984 AraportID:AT5G11150 Length:226 Species:Arabidopsis thaliana


Alignment Length:106 Identity:25/106 - (23%)
Similarity:61/106 - (57%) Gaps:5/106 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NDNYNQFGDHQIR--NNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQG 89
            ||.:::....|:.  :|:....::.:.:.::.:|..:|..|::|||:|.::|..|.::.:.::..
plant   105 NDEFSRVLSQQMEFYSNDPNADRMSRIKGEMSQVRNVMIENIDKVLDRGERLELLVDKTENMQGN 169

  Fly    90 ASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSV 130
            ..:|.:||.:.:...||.|:|:.|.|   .:||.::|.:::
plant   170 TFRFRKQARRYRTIMWWRNVKLTIAL---ILVLALVVYIAM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 21/85 (25%)
VAMP713NP_001331552.1 Longin 4..119 CDD:341428 3/13 (23%)
Synaptobrevin 124..212 CDD:395764 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.