DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and VAMP725

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_180826.2 Gene:VAMP725 / 817827 AraportID:AT2G32670 Length:285 Species:Arabidopsis thaliana


Alignment Length:116 Identity:42/116 - (36%)
Similarity:65/116 - (56%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ANDNYNQFG-----------DH--QIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLS 77
            ||....:||           ||  :|       .||.:.:|:|.||.|:|..|:||||:|.:|:.
plant   168 ANSLNREFGSKLKEHMQYCVDHPDEI-------SKLAKVKAQVTEVKGVMMENIEKVLDRGEKIE 225

  Fly    78 ELGERADQLEQGASQFEQQAGKLKRKQWWANMKM-MIILGVIAVVLLIIVL 127
            .|.::.:.|...|..|..|..|::||.|:.|||: :|:||:|..::|||:|
plant   226 LLVDKTENLRSQAQDFRTQGTKIRRKMWFENMKIKLIVLGIIITLILIIIL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 35/85 (41%)
VAMP725NP_180826.2 Longin 97..168 CDD:290490 42/116 (36%)
Synaptobrevin 192..>260 CDD:279324 28/74 (38%)
R-SNARE 195..253 CDD:277196 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.