DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and Sec22c

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_038938688.1 Gene:Sec22c / 687022 RGDID:1590146 Length:306 Species:Rattus norvegicus


Alignment Length:97 Identity:19/97 - (19%)
Similarity:39/97 - (40%) Gaps:24/97 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF 93
            ::|.....|::  :..:|..::.:::...||.:...:|...|               |...|...
  Rat   125 HFNHMSSSQMK--SGLEKIQEELKSQPPAVVSLEGTDVANGL---------------LNGHAPAH 172

  Fly    94 EQQAGKLKRKQWWANMKMMIILGVIAVVLLII 125
            .:.|..|:       ||.:..|||:::||.|:
  Rat   173 SEPAPNLR-------MKPVTALGVLSLVLNIM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 17/82 (21%)
Sec22cXP_038938688.1 Longin 5..123 CDD:341428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.