DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and si:ch73-234b20.5

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001280112.1 Gene:si:ch73-234b20.5 / 449923 ZFINID:ZDB-GENE-041008-183 Length:101 Species:Danio rerio


Alignment Length:86 Identity:34/86 - (39%)
Similarity:57/86 - (66%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWA 107
            |...||.|.|.:|::|..|::.|:.|||||.::|.:|..:.|.|:..|..|::.:..:.||.||.
Zfish    10 APPSKLNQVQDQVNDVKVILKDNINKVLERGERLDDLIGKTDDLQATADSFQRTSTHVARKMWWR 74

  Fly   108 NMKMMIILGVIAVVLLIIVLV 128
            |.|||||:||:.|.::::::|
Zfish    75 NTKMMIIIGVVVVAIIVLIIV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 33/85 (39%)
si:ch73-234b20.5NP_001280112.1 SNARE 12..79 CDD:304603 25/66 (38%)
Synaptobrevin 13..>79 CDD:279324 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.