DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and vamp1b

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001002532.1 Gene:vamp1b / 436805 ZFINID:ZDB-GENE-040718-265 Length:118 Species:Danio rerio


Alignment Length:125 Identity:66/125 - (52%)
Similarity:79/125 - (63%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NEAPSPSGSNNNDFPILPPPPNANDNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEK 68
            |.|.:|.|......|  .||||...|                ::||||||:|:|||.||||||:|
Zfish     8 NPAGAPGGPGGAGAP--APPPNTTSN----------------RRLQQTQAQVEEVVDIMRVNVDK 54

  Fly    69 VLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLV 128
            |||||||||||.:|||.|:.||||||..|.|||.|.||.|.|||||:|||.|:.:.|:.:
Zfish    55 VLERDQKLSELDDRADALQAGASQFESCAAKLKNKYWWKNCKMMIIMGVIGVLFVGIIFL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 56/85 (66%)
vamp1bNP_001002532.1 Synaptobrevin 30..117 CDD:279324 57/101 (56%)
R-SNARE_VAMP2 32..94 CDD:277223 45/61 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5254
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40678
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X424
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.