DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and sec22b

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_989156.1 Gene:sec22b / 394761 XenbaseID:XB-GENE-999421 Length:215 Species:Xenopus tropicalis


Alignment Length:109 Identity:29/109 - (26%)
Similarity:49/109 - (44%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DNYNQ-----FGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLE 87
            |||.|     :.|.:.|.|      |.....::.:|..||..|:|:||.|.:.||.|..:|..|.
 Frog   116 DNYIQKTKKSYIDSRARRN------LSSVNTELQDVQRIMVANIEEVLLRGEALSALDSKASNLS 174

  Fly    88 QGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVW 131
            ..:.::.|.|..|..:..:|.:..:.:..|     ::||.:..|
 Frog   175 TLSKKYRQDAKYLNMRSTYAKLAAVAVFSV-----MLIVYIRFW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 21/85 (25%)
sec22bNP_989156.1 Longin 3..126 CDD:341428 4/9 (44%)
R-SNARE_SEC22 132..195 CDD:277219 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.