DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and vamp2

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_989031.1 Gene:vamp2 / 394628 XenbaseID:XB-GENE-5788095 Length:114 Species:Xenopus tropicalis


Alignment Length:111 Identity:66/111 - (59%)
Similarity:80/111 - (72%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PILPPPPNANDNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGER 82
            |...||..|..:    |..|...|..:.::||||||:|||||.||||||:||||||.|||||.:|
 Frog     4 PAAGPPAAAPGD----GAPQGPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDSKLSELDDR 64

  Fly    83 ADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLV 128
            ||.|:.||||||..|.|||||.||.|:|||||:|||..::|||::|
 Frog    65 ADALQAGASQFETSAAKLKRKYWWKNLKMMIIMGVICAIILIIIIV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 59/85 (69%)
vamp2NP_989031.1 R-SNARE_VAMP2 28..90 CDD:277223 46/61 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X424
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.