DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and sybl1

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_005157192.1 Gene:sybl1 / 393236 ZFINID:ZDB-GENE-040426-1055 Length:220 Species:Danio rerio


Alignment Length:110 Identity:29/110 - (26%)
Similarity:55/110 - (50%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AAQKK----------LQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQA 97
            |||.|          |.:||.:||::.|||..|::.|.:|.::|..|.::.:.|...:..|:..:
Zfish   111 AAQMKHHSDPKGSDRLTETQMQVDDLKGIMVRNIDLVAQRGERLELLIDKTENLMDSSVTFKTTS 175

  Fly    98 GKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPSSSDSGSGGG 142
            ..|.......|:|:.:|:.::.:|:|..::         ||:.||
Zfish   176 RNLAHAMCMKNLKLTVIVVIVVLVVLYFIV---------SGACGG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 24/95 (25%)
sybl1XP_005157192.1 SNC1 1..172 CDD:227472 18/60 (30%)
Longin 29..98 CDD:290490
Synaptobrevin 122..210 CDD:279324 23/96 (24%)
R-SNARE_VAMP7 124..188 CDD:277224 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.