DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and nSyb

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster


Alignment Length:147 Identity:79/147 - (53%)
Similarity:92/147 - (62%) Gaps:21/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPNANDNYNQFGDHQI------RNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGE 81
            ||||.....:.||.:|      ....||||:||||||:|||||.|||.|||||||||.|||||.:
  Fly    11 PPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDD 75

  Fly    82 RADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPSSSDSGSGGGNKAI 146
            |||.|:||||||||||||||||.|..|:|||||:|||.   |::|.:...|..||..:.....|:
  Fly    76 RADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIG---LVVVGIIAKPYMSDDNAAPQPPAL 137

  Fly   147 TQ------------APP 151
            .|            |||
  Fly   138 QQQVAPASATAPDSAPP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 63/85 (74%)
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 62/83 (75%)
R-SNARE_VAMP2 40..102 CDD:277223 50/61 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448296
Domainoid 1 1.000 73 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E1_COG5143
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I3317
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm8786
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 1 1.000 - - X424
109.920

Return to query results.
Submit another query.