DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and Vamp4

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001102326.1 Gene:Vamp4 / 364033 RGDID:1309753 Length:141 Species:Rattus norvegicus


Alignment Length:99 Identity:31/99 - (31%)
Similarity:62/99 - (62%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQ 96
            :||.   ||:     |::..|.:||||:.:|:.|:.||:||.::|.||.::::.|...|:.|..:
  Rat    45 RFGP---RND-----KIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNR 101

  Fly    97 AGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSV 130
            :.:|:|:.||...|:..|:.:.|.:||::::..:
  Rat   102 SKQLRRQMWWRGCKIKAIMALAAAILLLMIITQI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 27/85 (32%)
Vamp4NP_001102326.1 R-SNARE_VAMP4 50..116 CDD:277222 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105078
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.