DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and vamp8

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_956053.1 Gene:vamp8 / 327007 ZFINID:ZDB-GENE-030131-5215 Length:124 Species:Danio rerio


Alignment Length:131 Identity:40/131 - (30%)
Similarity:73/131 - (55%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNANDNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQ 88
            ||:.       :|:...::....:::..|::||.|..||..||:::|.|.::|.:|..:::.||.
Zfish     6 PNST-------EHREGESSQDADRVKALQSQVDGVKDIMTQNVDRILARGERLDDLMGKSEDLEA 63

  Fly    89 GASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVL---VSVWPSSSDSGSGGGNKAITQAP 150
            ||..|:|.:.|:.|..||.|:|:::::.||.:|:|:|::   ..|.|.     ||...|..|..|
Zfish    64 GAQNFKQTSQKVARAFWWKNVKLIVLIVVIVLVILLIIIFLATGVIPV-----SGSAPKPPTVTP 123

  Fly   151 P 151
            |
Zfish   124 P 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 29/88 (33%)
vamp8NP_956053.1 Synaptobrevin 19..>85 CDD:279324 23/65 (35%)
R-SNARE_VAMP8 21..85 CDD:277221 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.