DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and Vamp3

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_476438.1 Gene:Vamp3 / 29528 RGDID:61880 Length:103 Species:Rattus norvegicus


Alignment Length:88 Identity:55/88 - (62%)
Similarity:70/88 - (79%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWAN 108
            :.::|||||.:|||||.||||||:||||||||||||.:|||.|:.||||||..|.|||||.||.|
  Rat    15 SNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN 79

  Fly   109 MKMMIILGVIAVVLLIIVLVSVW 131
            .||..|  .|:|:::|::::.||
  Rat    80 CKMWAI--GISVLVIIVIIIIVW 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 53/85 (62%)
Vamp3NP_476438.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/9 (56%)
R-SNARE_VAMP2 17..79 CDD:277223 46/61 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340330
Domainoid 1 1.000 125 1.000 Domainoid score I5330
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X424
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.