DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and snb-1

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001379956.1 Gene:snb-1 / 266648 WormBaseID:WBGene00004897 Length:109 Species:Caenorhabditis elegans


Alignment Length:88 Identity:59/88 - (67%)
Similarity:75/88 - (85%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWAN 108
            :.|:||||||:||||||||:||||||||||||||:|.:|||.|::||||||:.|..||||.||.|
 Worm    20 SNKRLQQTQAQVDEVVGIMKVNVEKVLERDQKLSQLDDRADALQEGASQFEKSAATLKRKYWWKN 84

  Fly   109 MKMMIILGVIAVVLLIIVLVSVW 131
            :|||||:..|.|:|:||::  :|
 Worm    85 IKMMIIMCAIVVILIIIIV--LW 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 58/85 (68%)
snb-1NP_001379956.1 R-SNARE_VAMP2 22..84 CDD:277223 47/61 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3531
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40678
Inparanoid 1 1.050 122 1.000 Inparanoid score I3317
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - otm14577
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.950

Return to query results.
Submit another query.