DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and syb1

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_594120.1 Gene:syb1 / 2541731 PomBaseID:SPAC6G9.11 Length:121 Species:Schizosaccharomyces pombe


Alignment Length:120 Identity:40/120 - (33%)
Similarity:67/120 - (55%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PILPPPPNANDNYNQFGDHQIRNNNAA-----QKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLS 77
            |.:|..|:|          .:|:.|||     ..|....|.::|:.|||||.|:.||.||.::|.
pombe     7 PYIPAEPSA----------AVRSGNAAASSTPNMKTAAIQQQIDDTVGIMRENISKVSERGERLD 61

  Fly    78 ELGERADQLEQGASQFEQQAGKLKRKQWWANMKM--MIILGVIAVVLLIIVLVSV 130
            .|.::.|.|...|..|.:.|.::::|.||.:|:|  .||:|:|  :||::::|.:
pombe    62 SLQDKTDNLAVSAQGFRRGANRVRKKMWWKDMRMRLCIIIGII--ILLVVIIVPI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 33/92 (36%)
syb1NP_594120.1 SNC1 <2..96 CDD:227472 32/98 (33%)
R-SNARE_Snc1 30..89 CDD:277227 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I2659
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I1906
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - otm47128
orthoMCL 1 0.900 - - OOG6_105078
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.