DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syb and snb-6

DIOPT Version :9

Sequence 1:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_495887.1 Gene:snb-6 / 188497 WormBaseID:WBGene00044062 Length:102 Species:Caenorhabditis elegans


Alignment Length:76 Identity:30/76 - (39%)
Similarity:50/76 - (65%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRK-QWWANM 109
            :|:.:|:.:::.|..||:.||:|::||..||.:|.|||.:||:.:..:.:.|.|:||: .|.|| 
 Worm    16 QKIMRTRQELNSVKIIMKENVQKIMERQGKLDDLVERAQKLEEASDVYVKCAVKIKREMSWKAN- 79

  Fly   110 KMMIILGVIAV 120
              .|..|:|||
 Worm    80 --AIRNGIIAV 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 30/76 (39%)
snb-6NP_495887.1 Synaptobrevin 14..102 CDD:366387 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.